Pfam domain
Pfam family: RNA_pol_Rpb4 (PF03874.18)
Uniprot AC: A0A287ADR4
RecName: RNA polymerase II subunit D
Begin-End: 73-180
Organism: Sus scrofa
Interaction Mode:   

Sequence:
RFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILD
DIQTKRSFQY
Structures of the domain A0A287ADR4 73-180
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gml X-ray 3.2 D 31-138 None
6gmh X-ray 3.1 D 31-138 None
6exv X-ray 3.6 D 31-138 None
6ted X-ray 3.1 D 31-138 None


© NPIDB team 2003 - 2021

text