Pfam domain
Pfam family: LacI (PF00356.23)
Uniprot AC: A0A2I4PGE9
RecName: LacI-type transcription factor (Fragment)
Begin-End: 21-66
Organism: Agrobacterium tumefaciens A6
Interaction Mode:   

Sequence:
TLKTIAYMTGLGITTVSRALKDAPDIGAETKERVRLIAQQIGYQPN
Structures of the domain A0A2I4PGE9 21-66
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7ce1 X-ray 3.2 B 21-66  H-Bb H-Mj H-Mn L-Bb L-Mj 
7ce1 X-ray 3.2 A 21-66  H-Bb H-Mj L-Bb L-Mj 
7ce1 X-ray 3.2 C 4-66  H-Bb H-Mj L-Bb L-Mj 
7ce1 X-ray 3.2 D 4-66  H-Bb H-Mj H-Mn L-Bb L-Mj 
7ce1 X-ray 3.2 G 5-66  H-Bb H-Mj L-Bb L-Mj 
7ce1 X-ray 3.2 H 21-66  H-Bb H-Mj H-Mn L-Bb L-Mj 
7ce1 X-ray 3.2 K 21-66  H-Bb H-Mj L-Bb L-Mj 
7ce1 X-ray 3.2 L 21-66  H-Bb H-Mj L-Bb 
7ce1 X-ray 3.2 O 4-66  H-Bb H-Mj L-Bb L-Mj 
7ce1 X-ray 3.2 P 5-66  H-Bb H-Mj H-Mn L-Bb L-Mj 
7ce1 X-ray 3.2 T 21-66  H-Mj H-Mn L-Bb L-Mj 
7ce1 X-ray 3.2 S 21-66  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text