Pfam domain
Pfam family: RNA_pol_Rpb2_7 (PF04560.22)
Uniprot AC: A0A2J0WBQ0
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 1071-1147
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
GGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRVKTYEAIVKGDNVPEPGVPESFKV
LIKELQSLGMDVKILSG
Structures of the domain A0A2J0WBQ0 1071-1147
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wvj X-ray 3.36 C 1071-1147 None


© NPIDB team 2003 - 2021

text