Pfam domain
Pfam family: RNA_pol_Rpb2_2 (PF04561.16)
Uniprot AC: A0A2J0WBQ0
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 140-295
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
RSPSVYFSGKVDKNGKKGFTATVIPNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRAL
GFGSDQEILDLIGENEYLRNTLDKDNTENSDKALLEIYERLRPGEPPTVENAKSLLDSRF
FDPKRYDLANVGRYKINKKLHIKNRLFNQRLAETLV
Structures of the domain A0A2J0WBQ0 140-295
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wvj X-ray 3.36 C 140-295 None


© NPIDB team 2003 - 2021

text