Pfam domain
Pfam family: RNA_pol_Rpb2_3 (PF04565.18)
Uniprot AC: A0A2J0WBQ0
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 469-537
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
QFMDQTNPLAELTHKRRLSALGPGGLTRERAGMEVRDVHYSHYGRMCPIETPEGPNIGLI
NSLSSYAKV
Structures of the domain A0A2J0WBQ0 469-537
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wvj X-ray 3.36 C 469-537  L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text