Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: A0A310TTQ1
RecName: Histone H3
Begin-End: 39-132
Organism: Xenopus laevis
Interaction Mode:   

Sequence:
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASE
AYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain A0A310TTQ1 39-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6jyl X-ray 3.37 E 40-131  H-Bb S-Bb L-Bb L-Mn 
6jyl X-ray 3.37 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6k1p X-ray 3.87 A 37-131  H-Bb S-Bb L-Bb 
6k1p X-ray 3.87 E 40-131  H-Bb S-Bb L-Bb 
6j99 X-ray 4.1 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6j99 X-ray 4.1 A 38-131  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2021

text