Pfam domain
Pfam family: RecA (PF00154.23)
Uniprot AC: A0A376NU07
RecName: Protein RecA
Begin-End: 35-270
Organism: Escherichia coli
Interaction Mode:   

Sequence:
SMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFI
DAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKA
EIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGN
ALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGIN
Structures of the domain A0A376NU07 35-270
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7jy6 X-ray 2.5 I 34-269 None
7jy7 X-ray 2.9 I 34-269 None
7jy8 X-ray 2.5 I 34-269 None
7jy9 X-ray 2.8 I 34-269 None


© NPIDB team 2003 - 2021

text