Pfam domain
Pfam family: RNA_pol_N (PF01194.19)
Uniprot AC: A0A4X1VYD0
RecName: DNA-directed RNA polymerases I, II, and III subunit RPABC5
Begin-End: 2-59
Organism: Sus scrofa
Interaction Mode:   

Sequence:
IIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKL
Structures of the domain A0A4X1VYD0 2-59
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ted X-ray 3.1 J 2-59 None


© NPIDB team 2003 - 2021

text