Pfam domain
Pfam family: E2F_TDP (PF02319.22)
Uniprot AC: A0AVK6
RecName: Transcription factor E2F8
Begin-End: 114-182
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KEKSLGLLCHKFLARYPNYPNPAVNNDICLDEVAEELNVERRRIYDIVNVLESLHMVSRL
AKNRYTWHG
Structures of the domain A0AVK6 114-182
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4yo2 X-ray 3.07 A 114-182  H-Bb H-Mj S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text