Pfam domain
Pfam family: E2F_TDP (PF02319.22)
Uniprot AC: A0AVK6
RecName: Transcription factor E2F8
Begin-End: 262-341
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KDKSLRVMSQKFVMLFLVSTPQIVSLEVAAKILIGEDHVEDLDKSKFKTKIRRLYDIANV
LSSLDLIKKVHVTEERGRKP
Structures of the domain A0AVK6 262-341
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4yo2 X-ray 3.07 A 262-339  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text