Pfam domain
Pfam family: IMS_C (PF11799.10)
Uniprot AC: A0QR77
RecName: DNA polymerase IV
Begin-End: 244-347
Organism: Mycolicibacterium smegmatis
Interaction Mode:  S-Bb S-Mj L-Bb 

Sequence:
PRSRSHVVTFPQDLTERREMDSAVRDLALQTLAEIVEQGRIVTRVAVTVRTSTFYTRTKI
RKLPAPSTDAGQIVDTALAVLDQFELDRPVRLLGVRLELAMDDV
Structures of the domain A0QR77 244-347
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6jun X-ray 2.51 A 244-343  S-Bb S-Mj L-Bb 
6jun X-ray 2.51 F 244-343  S-Bb S-Mj L-Bb 
6jus X-ray 2.5 A 244-343  S-Bb S-Mj L-Bb 
6jus X-ray 2.5 F 244-343  S-Bb S-Mj L-Bb 
6jur X-ray 2.06 A 244-343  S-Bb S-Mj L-Bb 
6jur X-ray 2.06 F 244-343  S-Bb L-Bb 
6juo X-ray 2.16 A 244-343  S-Bb S-Mj L-Bb 
6juo X-ray 2.16 F 244-343  S-Bb L-Bb 
6jum X-ray 1.78 A 244-343  S-Bb S-Mj L-Bb 
6jum X-ray 1.78 F 244-343  S-Bb L-Bb 
6jul X-ray 2.3 F 244-343  S-Bb L-Bb 
6jul X-ray 2.3 A 244-343  S-Bb S-Mj L-Bb 


© NPIDB team 2003 - 2021

text