Pfam domain
Pfam family: IMS (PF00817.22)
Uniprot AC: A0QR77
RecName: DNA polymerase IV
Begin-End: 8-156
Organism: Mycolicibacterium smegmatis
Interaction Mode:  H-Bb S-Bb L-Bb L-Mn 

Sequence:
VDLDQFLASVELRRRPDLRGQPVIVGGSGDPSEPRKVVTCASYEAREFGVHAGMPLRAAA
RRCPDATFLPSDPAAYDEASEQVMGLLRDLGHPLEVWGWDEAYLGADLPDESDPVEVAER
IRTVVAAETGLSCSVGISDNKQRAKVATG
Structures of the domain A0QR77 8-156
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6jun X-ray 2.51 A 8-156  S-Bb L-Bb 
6jun X-ray 2.51 F 8-156  S-Bb 
6jus X-ray 2.5 A 8-156  H-Bb L-Bb 
6jus X-ray 2.5 F 8-156  S-Bb L-Bb 
6jur X-ray 2.06 A 8-156  S-Bb 
6jur X-ray 2.06 F 8-156  S-Bb 
6juo X-ray 2.16 A 8-156  H-Bb L-Bb 
6juo X-ray 2.16 F 8-156  H-Bb S-Bb L-Bb 
6jum X-ray 1.78 A 8-156  L-Bb 
6jum X-ray 1.78 F 8-156  S-Bb L-Bb L-Mn 
6jul X-ray 2.3 F 8-156  H-Bb S-Bb L-Bb 
6jul X-ray 2.3 A 8-156  L-Bb 


© NPIDB team 2003 - 2021

text