Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.19)
Uniprot AC: A0QS66
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 1069-1177
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
PDDGGEEVVYDKLSKRQRLRVITHEDGTEGVLSDGDHVEVGDQLMEGAADPHEVLRVQGP
REVQIHLVKEVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFL
Structures of the domain A0QS66 1069-1177
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ccv X-ray 3.05 D 1089-1213 None


© NPIDB team 2003 - 2021

text