Pfam domain
Pfam family: RNA_pol_Rpb1_2 (PF00623.22)
Uniprot AC: A0QS66
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 419-561
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
GKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVER
QRPQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPQLVEGKAIQLHPLVCEAFNADFDG
DQMAVHLPLSAEAQAEARILMLS
Structures of the domain A0QS66 419-561
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dcf X-ray 3.45 D 419-561 None
6ccv X-ray 3.05 D 419-561 None
6vvt X-ray 2.9 D 419-561 None
5vi5 X-ray 3.2 D 419-561 None
6cce X-ray 3.05 D 419-561 None
5vi8 X-ray 2.76 D 419-561 None
5tw1 X-ray 2.76 D 419-561 None
6vvs X-ray 3.11 D 419-561 None
6vvv X-ray 3.2 D 419-561 None


© NPIDB team 2003 - 2021

text