Pfam domain
Pfam family: Ribosomal_S10 (PF00338.24)
Uniprot AC: A0QSD0
RecName: 30S ribosomal protein S10
Begin-End: 7-101
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
RIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVYCVIRSPHKYKDSREHFE
MRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ
Structures of the domain A0QSD0 7-101
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o5j X-ray 3.45 J 7-101 None
5zeu X-ray 3.7 j 7-101 None
5xyu X-ray 3.45 J 7-101 None
6dzk X-ray 3.6 J 7-101 None


© NPIDB team 2003 - 2021

text