Pfam domain
Pfam family: Ribosomal_S9 (PF00380.21)
Uniprot AC: A0QSP9
RecName: 30S ribosomal protein S9
Begin-End: 30-150
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
GRRKEAVVRVRLVPGTGQFNLDGRTLENYFPNKVHQQLIKAPLVTVDRVDQFDIYAHLDG
GGPSGQAGALRLAIARALILVQPEDRPALKKAGFLTRDPRAIERKKYGLKKARKAPQYSK
R
Structures of the domain A0QSP9 30-150
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o5j X-ray 3.45 I 30-150 None
5zeu X-ray 3.7 i 30-150 None
5xyu X-ray 3.45 I 30-148 None
6dzk X-ray 3.6 I 30-150 None


© NPIDB team 2003 - 2021

text