Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.24)
Uniprot AC: A0QWT1
RecName: DNA-directed RNA polymerase subunit omega
Begin-End: 39-102
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
ELLSRASSKYALVIYAAKRARQINDYYNQLGDGILEYVGPLVEPGLQEKPLSIALREIHG
DLLE
Structures of the domain A0QWT1 39-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dcf X-ray 3.45 E 39-102 None
6ccv X-ray 3.05 E 39-102 None
6vvt X-ray 2.9 E 39-102 None
5vi5 X-ray 3.2 E 39-102 None
6cce X-ray 3.05 E 39-102 None
5vi8 X-ray 2.76 E 39-102 None
5tw1 X-ray 2.76 E 39-102 None
6vvs X-ray 3.11 E 39-102 None
6vvv X-ray 3.2 E 39-102 None


© NPIDB team 2003 - 2021

text