Pfam domain
Pfam family: TetR_N (PF00440.25)
Uniprot AC: A0QX69
RecName: Transcriptional regulator, TetR family protein
Begin-End: 8-54
Organism: Mycolicibacterium smegmatis
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
VVAAATKILDDHGIADLTMRRLARELDVTPGALYWHFANKQELLGAV
Structures of the domain A0QX69 8-54
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5yej X-ray 2.7 A 8-54 None
5yej X-ray 2.7 C 8-54  H-Bb H-Mj L-Bb L-Mj 
5yej X-ray 2.7 B 8-54  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text