Pfam domain
Pfam family: DNA_pol_A (PF00476.22)
Uniprot AC: A0QYZ2
RecName: DNA polymerase I
Begin-End: 529-905
Organism: Mycolicibacterium smegmatis
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 

Sequence:
GMLEQLQSEFADQIRDAAEAAYSVIGKQINLGSPKQLQAVLFDELEMPKTKKTKTGYTTD
ADALQSLFEKTGHPFLQHLLAHRDATRLKVTVDGLLNSVASDGRIHTTFNQTIAATGRLS
STEPNLQNIPIRTEAGRRIRDAFVVGEGYAELMTADYSQIEMRIMAHLSRDAGLIEAFNT
GEDLHSFVASRAFSVPIDEVTPELRRRVKAMSYGLAYGLSAYGLAQQLKISTEEAKVQME
QYFDRFGGVRDYLRDVVDQARKDGYTSTVLGRRRYLPELDSSNRQVREAAERAALNAPIQ
GSAADIIKVAMINVDQAIKDAGLRSRILLQVHDELLFEVSEGEQGELEQLVREHMGNAYP
LDVPLEVSVGYGRSWDA
Structures of the domain A0QYZ2 529-905
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6vdd X-ray 1.9 A 529-905  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
6vdd X-ray 1.9 D 529-905  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text