Pfam domain
Pfam family: RbpA (PF13397.8)
Uniprot AC: A0QZ11
RecName: RNA polymerase-binding protein RbpA
Begin-End: 77-106
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
PPRTHWDMLLERRSVEELEELLKERLDLIK
Structures of the domain A0QZ11 77-106
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6cce X-ray 3.05 J 77-106  L-Bb 


© NPIDB team 2003 - 2021

text