Pfam domain
Pfam family: Toprim (PF01751.24)
Uniprot AC: A0R5D9
RecName: DNA topoisomerase 1
Begin-End: 16-138
Organism: Mycolicibacterium smegmatis
Interaction Mode:   

Sequence:
RLVIVESPTKARKIAGYLGSNYVVESSRGHIRDLPRNAADVPAKFKSEPWARLGVNVDQN
FEPLYIVSPEKKSTVTELKGLLKDVDELYLATDGDREGEAIAWHLLETLKPRVPVKRMVF
HEI
Structures of the domain A0R5D9 16-138
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6pcm X-ray 3.11 B 16-138 None
6pcm X-ray 3.11 A 16-138 None


© NPIDB team 2003 - 2021

text