Pfam domain
Pfam family: TetR_N (PF00440.25)
Uniprot AC: A0R6I8
RecName: Transcriptional regulator, TetR family protein
Begin-End: 18-64
Organism: Mycobacterium smegmatis
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
IVEATRALLLERGFDGLSIEAVAAKAGVGKQTIYRWWPSRHALVADV
Structures of the domain A0R6I8 18-64
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4jl3 X-ray 2.5 D 18-64  H-Bb H-Mj L-Bb 
4jl3 X-ray 2.5 C 18-64  H-Bb H-Mj L-Bb 
4jl3 X-ray 2.5 B 18-64  H-Bb H-Mj L-Bb 
4jl3 X-ray 2.5 A 18-64  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text