Pfam domain
Pfam family: RVT_1 (PF00078.29)
Uniprot AC: A1Z651
RecName: Gag-Pol polyprotein
Begin-End: 758-930
Organism: Xenotropic MuLV-related virus (isolate VP62)
Interaction Mode:   

Sequence:
VKKPGTNDYRPVQDLREVNKRVEDIHPTVPNPYNLLSGLPPSHQWYTVLDLKDAFFCLRL
HPTSQPLFAFEWRDPEMGISGQLTWTRLPQGFKNSPTLFDEALHRDLADFRIQHPDLILL
QYVDDLLLAATSEQDCQRGTRALLQTLGNLGYRASAKKAQICQKQVKYLGYLL
Structures of the domain A1Z651 758-930
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4hkq X-ray 3.04 A 95-273 None


© NPIDB team 2003 - 2021

text