Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: A2D895
RecName: 40S ribosomal protein S23, putative
Begin-End: 30-142
Organism: Trichomonas vaginalis
Interaction Mode:   

Sequence:
RRSLGTSIYKTPLEGTSMASGIVVGKVAVEAKQPNSAIRKAVRVQLKKNSKVVTAFVPRD
GSLRLIDDNDRVLIAGMGRSGRSVGDLPGCRFKVIKVAGFSLLALWLGKKEKP
Structures of the domain A2D895 30-142
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyi X-ray 3.35 X 30-142 None


© NPIDB team 2003 - 2021

text