Pfam domain
Pfam family: Ribosomal_S8 (PF00410.21)
Uniprot AC: A2DLW4
RecName: Ribosomal protein S15a
Begin-End: 5-130
Organism: Trichomonas vaginalis
Interaction Mode:   

Sequence:
SVLADALKAITNAERRGMRQVLIRPSSKVIIAFLKVMASRNYIGDFEVIDDHRSGKIVIN
LLGRLNKCVAICPRFDVGLGDLEMWQAKLLPSRQFGYVVLSTDKGIMDHEEARKHNAGGK
ILGMFF
Structures of the domain A2DLW4 5-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyi X-ray 3.35 W 5-130 None


© NPIDB team 2003 - 2021

text