Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: A2DNY3
RecName: Uncharacterized protein
Begin-End: 105-149
Organism: Trichomonas vaginalis
Interaction Mode:   

Sequence:
RRLQTQVHKRALANSVHHARTLVSHRHISVENQLVNQPAFLVWKE
Structures of the domain A2DNY3 105-149
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyi X-ray 3.35 J 105-149 None


© NPIDB team 2003 - 2021

text