Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: A2FC75
RecName: 40S ribosomal protein S4
Begin-End: 42-90
Organism: Trichomonas vaginalis
Interaction Mode:   

Sequence:
LPINIFLRDRLKYALTAKEAVAIVKRRLVKVDGKVRTNYRYPTGLMDVI
Structures of the domain A2FC75 42-90
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyi X-ray 3.35 E 42-90 None


© NPIDB team 2003 - 2021

text