Pfam domain
Pfam family: Ribosomal_S10 (PF00338.24)
Uniprot AC: A2FDE0
RecName: Ribosomal protein S10p/S20e, putative
Begin-End: 25-119
Organism: Trichomonas vaginalis
Interaction Mode:   

Sequence:
RLTITSSKLPNLQRVVGNLMGKLKKGNLEVRGPIPMPRRRLRITTRRAPCGNGTETYDHF
ELRIYKRVIDFQGTAEAVKQVTQIALEPDVHVEVS
Structures of the domain A2FDE0 25-119
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyi X-ray 3.35 U 25-120 None


© NPIDB team 2003 - 2021

text