Pfam domain
Pfam family: RNase_T (PF00929.26)
Uniprot AC: A3KPE8
RecName: Small RNA degrading nuclease 1
Begin-End: 141-291
Organism: Arabidopsis thaliana
Interaction Mode:   

Sequence:
VAVDCEMVLCEDGTEGLVRVGVVDRDLKVILDEFVKPNKPVVDYRTDITGITAEDIENAS
LSVVDIQETLQPFLSTGTILVGHSLNRDLEVLKIDHPKVIDTALVFKYPNTRKLRRPSLN
NLCKSILGYEVRKTGVPHDCVHDASAAMKLA
Structures of the domain A3KPE8 141-291
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5z9x X-ray 2.8 A 141-291 None


© NPIDB team 2003 - 2021

text