Pfam domain
Pfam family: z-alpha (PF02295.19)
Uniprot AC: A4FTK7
RecName: Protein ORF112
Begin-End: 218-277
Organism: Cyprinid herpesvirus 3
Interaction Mode:   

Sequence:
ISEEMNLKILAYLGTKQGAKAVHIAQSLGAQRSEVNRHLYRMSEDGRVRKHPQHPVWYLP
Structures of the domain A4FTK7 218-277
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4wcg X-ray 1.5 B 218-277 None
4wcg X-ray 1.5 A 218-277 None


© NPIDB team 2003 - 2021

text