Pfam domain
Pfam family: Piwi (PF02171.19)
Uniprot AC: A4WYU7
RecName: Uncharacterized protein
Begin-End: 455-756
Organism: Rhodobacter sphaeroides
Interaction Mode:   

Sequence:
RLPDDRNPYIHTKSLLLTLGVPTQQVRMPTVLLEPKSLQYTLQNFSIATYAKLNGTPWTV
NHDKAINDELVVGMGLAELSGSRTEKRQRFVGITTVFAGDGSYLLGNVSKECEYEGYSDA
IRESMTGILRELKKRNNWRPGDTVRVVFHAHRPLKRVDVASIVFECTREIGSDQNIQMAF
VTVSHDHPFVLIDRSERGLEAYKGSTARKGVFAPPRGAISRVGRLTRLLAVNSPQLIKRA
NTPLPTPLLVSLHPDSTFKDVDYLAEQALKFTSLSWRSTLPAATPVTIFYSERIAELLGR
LK
Structures of the domain A4WYU7 455-756
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6d9k X-ray 2 F 455-756 None
6d9k X-ray 2 A 455-756 None
6d8f X-ray 2.15 F 455-756 None
6d8f X-ray 2.15 A 455-756 None
5awh X-ray 2 B 454-756 None
5awh X-ray 2 A 455-756 None
6d8p X-ray 2.1 B 455-756 None
6d8p X-ray 2.1 A 455-756 None
6d8a X-ray 2.25 F 455-756 None
6d8a X-ray 2.25 A 455-756 None
6d95 X-ray 1.85 F 455-756 None
6d95 X-ray 1.85 A 455-756 None
6d9l X-ray 2.6 F 455-756 None
6d9l X-ray 2.6 A 455-756 None
6d92 X-ray 1.81 F 455-756 None
6d92 X-ray 1.81 A 455-756 None


© NPIDB team 2003 - 2021

text