Pfam domain
Pfam family: RNA_pol_L (PF01193.26)
Uniprot AC: A5U8D3
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 24-219
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
EPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNLKSL
VVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERG
RGYVPAVQNRASGAEIGRIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSIS
PRDALASAGKTLVELF
Structures of the domain A5U8D3 24-219
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6m7j X-ray 4.4 A 24-219 None
6m7j X-ray 4.4 B 24-219 None


© NPIDB team 2003 - 2021

text