Pfam domain
Pfam family: Piwi (PF02171.19)
Uniprot AC: A7TMA9
RecName: Uncharacterized protein
Begin-End: 888-1209
Organism: Vanderwaltozyma polyspora
Interaction Mode:   

Sequence:
YILYVLRRGNDSAVYDRLKYITDLKFGALNSCVVWDNFKKNSIQYNSNVVMKMNLKLLGS
NHSLSIENNKLLIDKESNLPILVLGSDVTHYPEKDQNSIASLVGSYDDKFTQFPGDYMLQ
DGPGEEIITNVGSLMLNRLKIYQKHNNGKLPTKIMYFRDGVSVDQFSQVVKIEVKSIKES
VRKFGPQLNGGNKYDPPVTCIATVKRNQVRFIPIQENAKNEKGEEVAVQSMGNVMPGTVV
DRGITSVAHFDFFIQSHQALKGTGVPCHYWCLYDENQSTSDYLQEICNNLCYIFGRSTTS
VKVPAPVYYADLLCTRATCFFK
Structures of the domain A7TMA9 888-1209
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5the X-ray 2.1 G 888-1209 None
5the X-ray 2.1 E 888-1209 None
5the X-ray 2.1 C 888-1209 None
5the X-ray 2.1 A 888-1209 None
4f1n X-ray 3.19 B 888-1209 None
4f1n X-ray 3.19 A 888-1209 None


© NPIDB team 2003 - 2021

text