Pfam domain
Pfam family: RNA_pol_L (PF01193.26)
Uniprot AC: A7ZSI4
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 29-228
Organism: Escherichia coli O139:H28
Interaction Mode:   

Sequence:
EPLERGFGHTLGNALRRILLSSMPGCAVTEVEIDGVLHEYSTKEGVQEDILEILLNLKGL
AVRVQGKDEVILTLNKSGIGPVTAADITHDGDVEIVKPQHVICHLTDENASISMRIKVQR
GRGYVPASTRIHSEEDERPIGRLLVDACYSPVERIAYNVEAARVEQRTDLDKLVIEMETN
GTIDPEEAIRRAATILAEQL
Structures of the domain A7ZSI4 29-228
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4yln X-ray 5.5 A 29-228 None
4yln X-ray 5.5 B 29-228 None
4yln X-ray 5.5 G 29-228 None
4yln X-ray 5.5 H 29-228 None
4yln X-ray 5.5 N 29-228 None
4yln X-ray 5.5 M 29-228 None
4ylo X-ray 6 B 29-228 None
4ylo X-ray 6 A 29-228 None
4ylo X-ray 6 G 29-228 None
4ylo X-ray 6 H 29-228 None
4ylo X-ray 6 M 29-228 None
4ylo X-ray 6 N 29-228 None


© NPIDB team 2003 - 2021

text