Pfam domain
Pfam family: RNA_pol_A_bac (PF01000.28)
Uniprot AC: A7ZSI4
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 58-186
Organism: Escherichia coli O139:H28
Interaction Mode:   

Sequence:
EVEIDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITH
DGDVEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACY
SPVERIAYN
Structures of the domain A7ZSI4 58-186
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4yln X-ray 5.5 A 58-178 None
4yln X-ray 5.5 B 58-185 None
4yln X-ray 5.5 G 58-178 None
4yln X-ray 5.5 H 58-185 None
4yln X-ray 5.5 N 58-185 None
4yln X-ray 5.5 M 58-178 None
4ylo X-ray 6 A 58-178 None
4ylo X-ray 6 B 58-185 None
4ylo X-ray 6 H 58-185 None
4ylo X-ray 6 G 58-178 None
4ylo X-ray 6 N 58-185 None
4ylo X-ray 6 M 58-178 None


© NPIDB team 2003 - 2021

text