Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.24)
Uniprot AC: A7ZTK1
RecName: DNA-directed RNA polymerase subunit omega
Begin-End: 8-60
Organism: Escherichia coli O139:H28
Interaction Mode:   

Sequence:
DAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
Structures of the domain A7ZTK1 8-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4yln X-ray 5.5 E 8-60 None
4yln X-ray 5.5 K 8-60 None
4yln X-ray 5.5 Q 8-60 None
4ylo X-ray 6 E 8-60 None
4ylo X-ray 6 K 8-60 None
4ylo X-ray 6 Q 8-60 None


© NPIDB team 2003 - 2021

text