Pfam domain
Pfam family: RNA_pol_Rpb2_2 (PF04561.16)
Uniprot AC: A7ZUK1
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 151-276
Organism: Escherichia coli O139:H28
Interaction Mode:   

Sequence:
RSPGVFFDSDKGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIIL
RALNYTTEQILDLFFEKVIFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEKGRRIT
ARHIRQ
Structures of the domain A7ZUK1 151-276
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4yln X-ray 5.5 C 151-276 None
4yln X-ray 5.5 I 151-276 None
4yln X-ray 5.5 O 151-276 None
4ylo X-ray 6 C 151-276 None
4ylo X-ray 6 I 151-276 None
4ylo X-ray 6 O 151-276 None


© NPIDB team 2003 - 2021

text