Pfam domain
Pfam family: RNA_pol_Rpb2_6 (PF00562.30)
Uniprot AC: A7ZUK1
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 717-1264
Organism: Escherichia coli O139:H28
Interaction Mode:   

Sequence:
VAKRGGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEP
VERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQEL
ACVSRDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLT
PEEKLLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQA
KKDLSEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAE
QYDELKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVI
SKINPIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQ
EVAKLREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIK
ELLKLGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQ
QPLGGKAQ
Structures of the domain A7ZUK1 717-1264
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4yln X-ray 5.5 C 717-1264 None
4yln X-ray 5.5 I 717-1264 None
4yln X-ray 5.5 O 717-1264 None
4ylo X-ray 6 C 717-1264 None
4ylo X-ray 6 I 717-1264 None
4ylo X-ray 6 O 717-1264 None


© NPIDB team 2003 - 2021

text