Pfam domain
Pfam family: RNA_pol_Rpb1_2 (PF00623.22)
Uniprot AC: A7ZUK2
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 386-486
Organism: Escherichia coli O139:H28
Interaction Mode:   

Sequence:
ELRGLATTIKAAKKMVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGK
AIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEARALMMS
Structures of the domain A7ZUK2 386-486
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4yln X-ray 5.5 D 386-486 None
4yln X-ray 5.5 J 386-486 None
4yln X-ray 5.5 P 386-486 None


© NPIDB team 2003 - 2021

text