Pfam domain
Pfam family: RNA_pol_Rpb1_4 (PF05000.19)
Uniprot AC: A7ZUK2
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 673-764
Organism: Escherichia coli O139:H28
Interaction Mode:   

Sequence:
VTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEEKQVSFNSIYMMADSGARG
SAAQIRQLAGMRGLMAKPDGSIIETPITANFR
Structures of the domain A7ZUK2 673-764
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4yln X-ray 5.5 D 673-764 None
4yln X-ray 5.5 J 673-764 None
4yln X-ray 5.5 P 673-764 None


© NPIDB team 2003 - 2021

text