Pfam domain
Pfam family: Piwi (PF02171.19)
Uniprot AC: A8D8P8
RecName: Piwi-like protein Siwi
Begin-End: 594-885
Organism: Bombyx mori
Interaction Mode:   

Sequence:
LILCVLARNYADRYEAIKKKCTVDRAVPTQVVCARNMSSKSAMSIATKVAIQINCKLGGS
PWTVDIPLPSLMVVGYDVCHDTRSKEKSFGAFVATLDKQMTQYYSIVNAHTSGEELSSHM
GFNIASAVKKFREKNGTYPARIFIYRDGVGDGQIPYVHSHEVAEIKKKLAEIYAGVEIKL
AFIIVSKRINTRIFVQRGRSGENPRPGTVIDDVVTLPERYDFYLVSQNVREGTIAPTSYN
VIEDTTGLNPDRIQRLTYKLTHLYFNCSSQVRVPSVCQYAHKLAFLAANSLH
Structures of the domain A8D8P8 594-885
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5guh X-ray 2.4 A 594-885 None


© NPIDB team 2003 - 2021

text