Pfam domain
Pfam family: DNA_photolyase (PF00875.20)
Uniprot AC: A8J8W0
RecName: Cryptochrome photoreceptor
Begin-End: 7-176
Organism: Chlamydomonas reinhardtii
Interaction Mode:  L-Bb 

Sequence:
SIIWFRKGLRLHDNPALLEACKDAKHVYPVFVLDPHFLQQSSYKVSVNRYNFLLESLEDL
QRSFQARGSRLLVLRGKPEEVFPRVFREWGVTQLCFEHDTEPYAKVRDAAVRRLAAEAGV
EVVTPISHTLYDTDMLVARNGGAAPLTMQSFTKLVDRVGDPPAPAPDPPA
Structures of the domain A8J8W0 7-176
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fn0 X-ray 2.9 A 7-176  L-Bb 


© NPIDB team 2003 - 2021

text