Pfam domain
Pfam family: Toprim (PF01751.24)
Uniprot AC: B0V9T6
RecName: DNA topoisomerase 4 subunit B
Begin-End: 413-523
Organism: Acinetobacter baumannii
Interaction Mode:   

Sequence:
ELFIVEGDSAGGSAKQARDKNFQAIMPIRGKILNTWEVSSDEVLASQEVHDIAIAIGVDP
GSDDLSELRYGKICILADADSDGLHIATLLCALFVKHFPALVEEGHLYVAM
Structures of the domain B0V9T6 413-523
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2xkk X-ray 3.25 C 390-500  H-Bb S-Bb L-Bb L-Mn 
2xkk X-ray 3.25 A 390-500  H-Bb S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text