Pfam domain
Pfam family: DNA_gyraseB_C (PF00986.23)
Uniprot AC: B0V9T6
RecName: DNA topoisomerase 4 subunit B
Begin-End: 555-617
Organism: Acinetobacter baumannii
Interaction Mode:   

Sequence:
KNPQITRFKGLGEMNAIQLRETTMDPNTRRLVQLDLDDAHLTAGLLDKLLAKKRAADRKQ
WLE
Structures of the domain B0V9T6 555-617
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2xkk X-ray 3.25 C 528-594  H-Bb 
2xkk X-ray 3.25 A 528-594  H-Bb L-Mj 


© NPIDB team 2003 - 2021

text