Pfam domain
Pfam family: DNA_topoisoIV (PF00521.22)
Uniprot AC: B0VP98
RecName: DNA topoisomerase 4 subunit A
Begin-End: 33-470
Organism: Acinetobacter baumannii
Interaction Mode:   

Sequence:
RALPHISDGLKPVQRRIVYAMSELGLKSSGKPKKSARTVGDVLGKYHPHGDSACYEAMVL
MAQPFSYRYPLIEGQGNWGSPDDPKSFAAMRYTEAKLSAYSELLLSELGQGTSEWQDNFD
GSLKEPITLPARVPNILLNGTTGIAVGMATDIPPHNLREVVKGTIALIRNPQTSDEKLAE
YIPAPDLPTKAEIITPPEELLKIQTTGRGSYRMRAVYTIEKNEIVITELPYQVSGSKVIT
QIADQMQAKKLPLVVDVRDESDHENPTRLVIVLRSNRIDAEAVMSHLFATTDLESSYRVN
LNMIGEDGRPQVKSIRRILLEWIEIRKKTVTRRLQYHLNRIEKRLHILAGLLIAYLDIDT
VIRIIREEDQPKPVLMEHFNIDEIQAEAILELKLRHLAKLEEMEIRHEQDELSAKAAIIR
EQLENPESLKNLIISELK
Structures of the domain B0VP98 33-470
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2xkk X-ray 3.25 C 1033-1470  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
2xkk X-ray 3.25 A 1033-1470  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 


© NPIDB team 2003 - 2021

text