Pfam domain
Pfam family: Crl (PF07417.14)
Uniprot AC: B1J0Z4
RecName: Sigma factor-binding protein Crl
Begin-End: 8-115
Organism: Escherichia coli
Interaction Mode:   

Sequence:
PKSRLIKKFTALGPYIREGKCEDNRFFFDCLAVCVNVKPAPEVREFWGWWMELEAQESRF
TYSYQFGLFDKAGDWKSVPVKDTEVVERLEHTLREFHEKLRELLTTLN
Structures of the domain B1J0Z4 8-115
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kj6 X-ray 3.8 J 8-115 None


© NPIDB team 2003 - 2021

text