Pfam domain
Pfam family: RNA_pol_Rpb2_45 (PF10385.11)
Uniprot AC: B2SQQ1
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 619-684
Organism: Xanthomonas oryzae pv. oryzae
Interaction Mode:   

Sequence:
YRKVLDGKVSDDVEYLSAIEENEYVIAQANALTDAKNMLTEQFVPCRFQGESLLKPPSEV
HFMDVS
Structures of the domain B2SQQ1 619-684
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6j9e X-ray 3.41 C 619-684 None


© NPIDB team 2003 - 2021

text