Pfam domain
Pfam family: RNA_pol_L (PF01193.26)
Uniprot AC: B2SQT4
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 29-227
Organism: Xanthomonas oryzae pv. oryzae
Interaction Mode:   

Sequence:
EPLERGYGHTLGNALRRVLLSSIPGFAITEVEIDGVLHEYTTVEGLQEDVLDVLLNLKDV
AIRMHSGDSATLSLSKQGPGTVTAADIRTDHNVEIINGDHVICHLTKDTALNMRLKIERG
FGYQPAAARRRPDEETRTIGRLMLDASFSPVRRVAYAVEAARVEQRTDLDKLVIDIETNG
TIDAEEAVRTAADILSDQL
Structures of the domain B2SQT4 29-227
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6j9f X-ray 3.95 A 29-227 None
6j9f X-ray 3.95 B 29-227 None
6j9e X-ray 3.41 A 29-227 None
6j9e X-ray 3.41 B 29-227 None


© NPIDB team 2003 - 2021

text