Pfam domain
Pfam family: DNA_topoisoIV (PF00521.22)
Uniprot AC: B5XU60
RecName: DNA topoisomerase 4 subunit A
Begin-End: 29-466
Organism: Klebsiella pneumoniae
Interaction Mode:   

Sequence:
RALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSARTVGDVLGKYHPHGDSACYEAMVL
MAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLSKYAELLLSELGQGTVDWVPNFD
GTLQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLREVAKAAITLIEQPKTTLDELLD
IVQGPDFPTEAEIITSRAEIRKIYQNGRGSVRMRAVWSKEDGAVVISALPHQVSGAKVLE
QIAAQMRNKKLPMVDDLRDESDHENPTRLVIVPRSNRVDMEQVMNHLFATTDLEKSYRIN
LNMIGLDGRPAVKNLLEILSEWLVFRRDTVRRRLNHRLEKVLKRLHILEGLLVAFLNIDE
VIEIIRTEDEPKPALMSRFGISETQAEAILELKLRHLAKLEEMKIRGEQDELEKERDQLQ
AILASERKMNNLLKKELQ
Structures of the domain B5XU60 29-466
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6waa X-ray 3.2 D 1029-1466  S-Bb S-Mj S-Mn L-Bb L-Mj 
6waa X-ray 3.2 B 1029-1466  S-Bb S-Mj S-Mn L-Bb L-Mj 
6waa X-ray 3.2 H 1029-1466  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
6waa X-ray 3.2 F 1029-1466  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 


© NPIDB team 2003 - 2021

text