Pfam domain
Pfam family: Ribosomal_S10 (PF00338.24)
Uniprot AC: B6KQG9
RecName: 40s ribosomal protein S20, putative
Begin-End: 135-229
Organism: Toxoplasma gondii
Interaction Mode:   

Sequence:
RITLTSKDLKSIERVCTELINGAKEKNLQVAGPVRLPVKTLRITTRKSPCGEGTNTWDRF
ELRIYKRLIDLHSPSDVVKQITSINIDPGVEVEVT
Structures of the domain B6KQG9 135-229
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xxu X-ray 3.35 U 135-229 None


© NPIDB team 2003 - 2021

text